PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G30390.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 218aa    MW: 23221.5 Da    PI: 5.8897
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G30390.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10137175442
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e 
  OPUNC01G30390.2 137 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEV 175
                      5999********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14134198IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795136188IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.7E-14138192No hitNo description
SuperFamilySSF579593.52E-12138192No hitNo description
PfamPF001705.0E-10138185IPR004827Basic-leucine zipper domain
CDDcd147033.62E-25139190No hitNo description
PROSITE patternPS000360141156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAQLPPKIPV AAPGHHQHWA SAGGAGDAAW ADEFAEFAAS RRGAHRRSLS DSVAFVEVAP  60
AGCGAGGEFD RLDDDQLMSM FPDEGGSSAP GSDNGGSDSD GGDKHAAAQS DDGQHAAGEP  120
TQEQAAAASP TELIRDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTT LQNEVSVLSP  180
RVAFLDQQRT ILTVGNSHLK QRIAALAQDK IFKDDDRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085530.0AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634100.11e-127PREDICTED: basic leucine zipper 6
SwissprotQ5JMK61e-129BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A0E0JNV21e-157A0A0E0JNV2_ORYPU; Uncharacterized protein
STRINGBGIOSGA004481-PA1e-127(Oryza sativa Indica Group)
STRINGLOC_Os01g55150.11e-127(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.15e-43bZIP family protein